AHR Antibody
Produktgrößen
100 ug
£ POA
LS-C756379-100UG
Über dieses Produkt
- SKU:
- LS-C756379
- Zusätzliche Namen:
- AHR, Ah receptor, AH-receptor, Aryl hydrocarbon receptor, BHLHe76, Aromatic hydrocarbon receptor
- Anwendung:
- Flow Cytometry, IHC-Frozen, IHC-Paraffin, Immunocytochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- No cross reactivity with other proteins.
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:782063