BCL2 / Bcl-2 Antibody (DY488)
Produktgrößen
100 ug
£ POA
LS-C756362-100UG
Über dieses Produkt
- SKU:
- LS-C756362
- Zusätzliche Namen:
- BCL2, Apoptosis regulator Bcl-2, B-cell CLL/lymphoma 2, B-cell lymphoma protein 2, Bcl-2, PPP1R50
- Anwendung:
- Flow Cytometry
- Buffer:
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Klonalität:
- Polyclonal
- Konjugat:
- DyLight™ 488
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140 aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
- Isotyp:
- IgG
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- No cross reactivity with other proteins.
- Lagerbedingungen:
- 2-8[o]C Do not freeze. Protect from light.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:782046