4E-BP2 / EIF4EBP2 Antibody
Produktgrößen
100 ul
LS-C748725-100UL
20 ul
LS-C748725-20UL
Über dieses Produkt
- SKU:
- LS-C748725
- Zusätzliche Namen:
- EIF4EBP2, 4E-BP2, 4EBP2, EIF4E-binding protein 2, PHASII
- Anwendung:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 61-120 of human EIF4EBP2 (NP_004087.1). DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
- Isotyp:
- IgG
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:774322