AKAP7 Antibody
Produktgrößen
100 ul
£ POA
LS-C747106-100UL
20 ul
£ POA
LS-C747106-20UL
Über dieses Produkt
- SKU:
- LS-C747106
- Zusätzliche Namen:
- AKAP7, A-kinase anchor protein 9 kDa, A-kinase anchor protein 18 kDa, AKAP-7 isoforms alpha and beta, AKAP-7 isoform gamma, AKAP 18, AKAP15, AKAP18, PRKA7 isoform gamma, PRKA7 isoforms alpha/beta
- Anwendung:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human AKAP7 (NP_004833.1). MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
- Isotyp:
- IgG
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:772703