ANGPTL3 Antibody
Produktgrößen
100 ug
£ POA
LS-C662762-100UG
Über dieses Produkt
- SKU:
- LS-C662762
- Zusätzliche Namen:
- ANGPTL3, ANGPT5, ANG-5, Angiopoietin-5, Angiopoietin-like 3, Angiopoietin-related protein 3, FHBL2, Angiopoietin 5, Angiopoietin-like protein 3
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human ANGPTL3 (RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN).
- Physischer Zustand:
- Lyophilized
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed principally in liver. Weakly expressed in kidney. Binds to adipocytes. Increased expression and colocalization with activated ITGB3 in glomeruli of patients with nephrotic syndrome showing effaced podocyte foot processes (at protein level).
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:677067