ACE / CD143 Antibody
Produktgrößen
100 ug
£ POA
LS-C662617-100UG
Über dieses Produkt
- SKU:
- LS-C662617
- Zusätzliche Namen:
- ACE, ACE1, Angiotensin-converting enzyme, CD143, CD143 antigen, Carboxycathepsin, DIPEPTIDYL CARBOXYPEPTIDASE, DCP, Dipeptidyl carboxypeptidase I, ICH, Kininase II, MVCD3, Peptidyl-dipeptidase A, Peptidase P, DCP1, Dipeptidyl carboxypeptidase 1, Testicular ECA
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).
- Physischer Zustand:
- Lyophilized
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Testis-specific isoform is expressed in spermatocytes, adult testis.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676922