BDKRB2/Bradykinin B2 Receptor Antibody
Produktgrößen
100 ug
£ POA
LS-C662333-100UG
Über dieses Produkt
- SKU:
- LS-C662333
- Zusätzliche Namen:
- BDKRB2, BK-2 receptor, Bradykinin type-2 receptor, B2R, Bradykinin B2 receptor, BRB2, BK-2R, BK-2Rs, BK2, B2 bradykinin receptor, B2bkr, BK-2, BKR2, Bradykinin receptor B2
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human BDKRB2 (357-391 aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Ubiquitous. Widespread in normal smooth muscle tissue and neurons. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676637