ADAM2 / Fertilin Beta Antibody
Produktgrößen
100 ug
£ POA
LS-C662265-100UG
Über dieses Produkt
- SKU:
- LS-C662265
- Zusätzliche Namen:
- ADAM2, ADAM 2, CRYN1, CRYN2, CT15, ADAM metallopeptidase domain 2, FTNB, Fertilin, Fertilin beta, Fertilin subunit beta, PH-30, PH-30b, PH30, PH30-beta, Cancer/testis antigen 15
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ADAM2 (231-274 aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676562