AF5Q31 / AFF4 Antibody
Produktgrößen
100 ug
£ POA
LS-C662207-100UG
Über dieses Produkt
- SKU:
- LS-C662207
- Zusätzliche Namen:
- AFF4, AF4/FMR2 family member 4, AF4/FMR2 family, member 4, AF5Q31, MCEF, Protein AF-5q31
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human AFF4 (6-53 aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Ubiquitously expressed. Strongly expressed in heart, placenta, skeletal muscle, pancreas and to a lower extent in brain. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676481