ALOX12 / 12 Lipoxygenase Antibody
Produktgrößen
100 ug
£ POA
LS-C662147-100UG
Über dieses Produkt
- SKU:
- LS-C662147
- Zusätzliche Namen:
- ALOX12, 12S-lipoxygenase, 12-lipoxygenase, 12S-LOX, 12(S)-lipoxygenase, 12-LOX, 12 Lipoxygenase, Arachidonate 12-lipoxygenase, LOG12, Platelet 12-LOX, Platelet-type 12-lipoxygenase, Platelet-type lipoxygenase 12
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human 12 Lipoxygenase (186-231 aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed in vascular smooth muscle cells. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676394