ABCG8 Antibody
Produktgrößen
100 ug
£ POA
LS-C662100-100UG
Über dieses Produkt
- SKU:
- LS-C662100
- Zusätzliche Namen:
- ABCG8, Sterolin-2, STSL, GBD4, Sterolin 2
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371 aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Strongly expressed in the liver, lower levels in the small intestine and colon. Detectable in a wide variety of human tissues.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676319