AIF1 / IBA1 Antibody
Produktgrößen
100 ug
£ POA
LS-C662093-100UG
Über dieses Produkt
- SKU:
- LS-C662093
- Zusätzliche Namen:
- AIF1, AIF-1, Em:AF129756.17, G1, IRT-1, Protein G1, IBA1, IRT1
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Iba1 (99-133 aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Detected in T-lymphocytes and peripheral blood mononuclear cells. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676306