ANGPTL4 Antibody
Produktgrößen
100 ug
£ POA
LS-C662068-100UG
Über dieses Produkt
- SKU:
- LS-C662068
- Zusätzliche Namen:
- ANGPTL4, Angiopoietin-like 4, Angiopoietin-related protein 4, Angiopoietin-like protein 4, Fasting-induced adipose factor, NL2, PGAR, Pp1158, ARP4, FIAF, HFARP
- Anwendung:
- ELISA, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ANGPTL4 (369-406 aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676266