ASL / Argininosuccinate Lyase Antibody
Produktgrößen
100 ug
£ POA
LS-C662014-100UG
Über dieses Produkt
- SKU:
- LS-C662014
- Zusätzliche Namen:
- ASL, ASAL, Argininosuccinate lyase, Argininosuccinase, Arginosuccinase
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:676172