ACTN3 Antibody
Produktgrößen
100 ug
£ POA
LS-C661871-100UG
Über dieses Produkt
- SKU:
- LS-C661871
- Zusätzliche Namen:
- ACTN3, Actinin, alpha 3, Alpha-actinin skeletal muscle, Alpha-actinin-3, F-actin cross-linking protein
- Anwendung:
- Flow Cytometry, IHC-Paraffin, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed only in a subset of type 2 skeletal muscle fibers. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:675958