ABCB2 / TAP1 Antibody
Produktgrößen
100 ug
£ POA
LS-C490496-100UG
Über dieses Produkt
- SKU:
- LS-C490496
- Zusätzliche Namen:
- TAP1, ABC17, ABCB2, APT1, D6S114E, ABC transporter, MHC 1, Ham1, Peptide transporter TAP1, PSF1, TAP1N, MTP1, Peptide transporter PSF1, PSF-1, Peptide supply factor 1, RING4, Y3
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:503472