BMP4 Antibody
Produktgrößen
100 ug
£ POA
LS-C490361-100UG
Über dieses Produkt
- SKU:
- LS-C490361
- Zusätzliche Namen:
- BMP4, BMP-2B, BMP-4, BMP2B, BMP2B1, Bone morphogenetic protein 2B, Bone morphogenetic protein 4, DVR4, MCOPS6, OFC11, Zyme
- Anwendung:
- ELISA, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND of human BMP4 were used as the immunogen for the BMP4 antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:503337