ADCY3 / Adenylate Cyclase 3 Antibody (Cy3)
Produktgrößen
100 ul
£ POA
LS-C409419-100UL
20 ul
£ POA
LS-C409419-20UL
Über dieses Produkt
- SKU:
- LS-C409419
- Zusätzliche Namen:
- ADCY3, AC-III, AcIII, Adenylyl cyclase 3, AC3, Adenylate cyclase type III, ATP pyrophosphate-lyase 3, Adenylate cyclase 3, Adenylate cyclase type 3, Adenylyl cyclase, type III, KIAA0511
- Anwendung:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Klonalität:
- Polyclonal
- Konjugat:
- Cyanine 3
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLV
- Isotyp:
- IgG
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- Human ADCY3 / Adenylate Cyclase 3
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:421784