ABCB2 / TAP1 Antibody (aa438-471)
Produktgrößen
100 ug
£ POA
LS-C408034-100UG
Über dieses Produkt
- SKU:
- LS-C408034
- Zusätzliche Namen:
- TAP1, ABC17, ABCB2, APT1, D6S114E, ABC transporter, MHC 1, Ham1, Peptide transporter TAP1, PSF1, TAP1N, MTP1, Peptide transporter PSF1, PSF-1, Peptide supply factor 1, RING4, Y3
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471 aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420398