BMP4 Antibody (aa293-324)
Produktgrößen
100 ug
£ POA
LS-C407900-100UG
Über dieses Produkt
- SKU:
- LS-C407900
- Zusätzliche Namen:
- BMP4, BMP-2B, BMP-4, BMP2B, BMP2B1, Bone morphogenetic protein 2B, Bone morphogenetic protein 4, DVR4, MCOPS6, OFC11, Zyme
- Anwendung:
- ELISA, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human BMP-4 (293-324 aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420264