ARID1A / BAF250 Antibody (aa1021-1053)
Produktgrößen
100 ug
£ POA
LS-C407897-100UG
Über dieses Produkt
- SKU:
- LS-C407897
- Zusätzliche Namen:
- ARID1A, BAF250, BAF250a, BRG1-associated factor 250a, C1orf4, BRG1-associated factor 250, ELD, HOSA1, Osa homolog 1, OSA1, OSA1 nuclear protein, SMARCF1, MRD14, p270, B120, BM029, Brain protein 120, C10rf4, HELD, SWI-like protein, SWI/SNF complex protein p270
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053 aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Bovine, Canine, Guinea Pig, Hamster, Horse, Human, Mouse, Other Mammal, Porcine, Rabbit, Rat, Sheep
- Versandbedingungen:
- Ambient
- Spezifität:
- Highly expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and PBL, and at a much lower level in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420261