APBB1 / FE65 Antibody (aa21-56)
Produktgrößen
100 ug
£ POA
LS-C407896-100UG
Über dieses Produkt
- SKU:
- LS-C407896
- Zusätzliche Namen:
- APBB1, FE65, Adaptor protein FE65a2, Protein Fe65, Stat-like protein, MGC:9072, RIR
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human FE65 (21-56 aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Bovine, Guinea Pig, Horse, Human, Mouse, Porcine, Rat, Sheep
- Versandbedingungen:
- Ambient
- Spezifität:
- Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420260