AHSG / Fetuin A Antibody (aa33-65)
Produktgrößen
100 ug
£ POA
LS-C407781-100UG
Über dieses Produkt
- SKU:
- LS-C407781
- Zusätzliche Namen:
- AHSG, A2HS, Alpha-2-Z-globulin, Fetuin, Fetuin-A, AHS, Alpha-2-HS-glycoprotein, Ba-alpha-2-glycoprotein, FETUA, HSGA
- Anwendung:
- ELISA, IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Fetuin A (33-65 aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420145