AQP1 / Aquaporin 1 Antibody (aa240-269)
Produktgrößen
100 ug
£ POA
LS-C407687-100UG
Über dieses Produkt
- SKU:
- LS-C407687
- Zusätzliche Namen:
- AQP1, Aquaporin-1, AQP-1, AQP-CHIP, Aquaporin 1, Aquaporin-CHIP, CHIP28, Colton blood group, Urine water channel, CO
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Aquaporin 1 (240-269 aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Bovine, Human, Mouse, Rat, Sheep
- Versandbedingungen:
- Ambient
- Spezifität:
- Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver. .
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420051