AQP2 / Aquaporin 2 Antibody (aa241-271)
Produktgrößen
100 ug
£ POA
LS-C407686-100UG
Über dieses Produkt
- SKU:
- LS-C407686
- Zusätzliche Namen:
- AQP2, AQP-CD, ADH water channel, Aquaporin 2 (collecting duct), AQP-2, Aquaporin 2, Aquaporin-CD, Aquaporin-2, Water-channel aquaporin 2, WCH-CD
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Aquaporin 2 (241-271 aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed in renal collecting tubules.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:420050