AML1 / RUNX1 Antibody (aa227-257)
Produktgrößen
100 ug
£ POA
LS-C389189-100UG
Über dieses Produkt
- SKU:
- LS-C389189
- Zusätzliche Namen:
- RUNX1, AMLCR1, Aml1 oncogene, AML1, AML1-EVI-1, CBF-alpha-2, CBFA2, Acute myeloid leukemia 1, EVI-1, PEBP2A2, PEA2-alpha B, AML1-EVI-1 fusion protein, Oncogene AML-1, PEBP2-alpha B, PEBP2aB
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Bovine, Hamster, Rabbit, Horse, Pig, Zebra finch, Dog (100%); Chicken (97%); Opossum, Guinea pig, Platypus, Lizard (90%); Elephant (84%).
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Bovine, Canine, Hamster, Horse, Human, Mouse, Porcine, Rabbit, Rat, Sheep
- Versandbedingungen:
- Ambient
- Spezifität:
- Human AML1 / RUNX1
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles., -20[o]C reconstituted. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:401382