ABCB1 / MDR1 / P Glycoprotein Antibody (aa621-650)
Produktgrößen
100 ug
£ POA
LS-C357450-100UG
Über dieses Produkt
- SKU:
- LS-C357450
- Zusätzliche Namen:
- ABCB1, ABC20, Abcb1b, CLCS, Colchicin sensitivity, CD243, IBD13, gp170, MDR1, Multidrug resistance protein 1, P glycoprotein, P-glycoprotein 1, P-GP, CD243 antigen, PGY1
- Anwendung:
- IHC-Frozen, IHC-Paraffin, Immunohistochemistry
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650 aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Non-human Primate, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- Expressed in liver, kidney, small intestine and brain.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:368774