BMI1 / PCGF4 Antibody (aa135-165)
Produktgrößen
100 ug
£ POA
LS-C343996-100UG
Über dieses Produkt
- SKU:
- LS-C343996
- Zusätzliche Namen:
- BMI1, BMI-1, Flvi-2/bmi-1, FLVI2/BMI1, PCGF4, Polycomb group protein Bmi1, Polycomb complex protein BMI-1, Dna-binding protein bmi-1, Polycomb group ring finger 4, RING finger protein 51, RNF51
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165 aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Horse, Human, Mouse, Non-human Primate, Porcine, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:354860