AATF Antibody (aa171-220)
Produktgrößen
50 ul
£501,00
LS-B17062-50UL
Über dieses Produkt
- SKU:
- LS-B17062
- Zusätzliche Namen:
- AATF, CHE1, DED, Rb-binding protein Che-1, CHE-1, Protein AATF
- Anwendung:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, 0.09% sodium azide, 2% sucrose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located between aa171-220 of human AATF (Q9NY61, NP_036270) within the region EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Rabbit (100%); Monkey, Elephant (92%); Marmoset (91%); Galago (85%); Bat, Horse (84%).
- Isotyp:
- IgG
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Spezifität:
- Human AATF
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:857485