Neuropeptide Y (human, rat)
Produktgrößen
0.5 mg
£214,00
ECH-611-26-0.5MG
1 mg
£330,00
ECH-611-26-1MG
Über dieses Produkt
- SKU:
- ECH-611-26
- CAS Number:
- 90880-35-6
- Weitere Details:
- CAS Number: 90880-35-6 \nMolecular Weight: 4269.09 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 \nSequence (1-letter): YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 \nStorage: -20 ?C or below \nSolubility: water 1 mg/mL \n \nNeuropeptide Y (NPY) is a peptide that is abundant in the central and peripheral nervous system that plays a major role in controlling appetite, blood pressure, cardiac contractility, and intestinal secretion. NPY is a vasonconstrictor that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Inhibition of NPY synthesis regulates food intake and metabolism implicating a role in obesity. This NPY amino acid sequence is homologous for human, rat, rabbit, and guinea pig. \nReferences \n1. Tatemoto, K., Carlquist, M. and Mutt, V. (1982) ?Neuropeptide Y-a novel brain peptide with structural similarities to peptide YY and pancreatic polypeptide? Nature 296: 659-660. \n2. Stephens, T.W. et al. (2002) ?The role of neuropeptide Y in the antiobesity action of the obese gene product? Nature 377: 530-532 \n3.O?Barr, S. and Cooper, N.R. (2000) ?The C5a complement activation peptide increases IL-1? and IL-6 release from amyloid-? primed human monocytes: implications for Alzheimer?s disease? J. Neuroimmunol. 109: 87?94., Echelon
- Molekulargewicht:
- 4269.09
- Sequenz:
- Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/neuropeptide-y-human-rat/

