Glucagon-like Peptide-1, human
Produktgrößen
0.5 mg
£343,00
ECH-471-26-0.5MG
1 mg
£546,00
ECH-471-26-1MG
Über dieses Produkt
- SKU:
- ECH-471-26
- CAS Number:
- 87805-34-3
- Weitere Details:
- CAS Number: 87805-34-3 \nMolecular Weight: 4167.03 \nSalt Form: TFA \nPurity: >95% \nSequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH \nSequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH \nStorage: -20 ?C or below \nSolubility: water to 5 mg/mL \n \nGlucagon-like peptide-1 (GLP-1) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat # 471-39 and 471-28, respectively) which are produced as a result of selective cleavage of proglucagon. \nReferences \n1. Baggio, L.L. and Drucker, D.J. (2007) ?Biology of Incretins: GLP-1 and GIP? Gastroenterology 132 (6): 2131-57. \n2. Kastin, A.J., Akerstrom, V. and Pan, W. (2002) ?Interactions of glucagon-like peptide-1 (GLP-1) with the blood-brain barrier? J. Mol. Neurosci. 18 (1-2): 7-14., Echelon
- Molekulargewicht:
- 4167.03
- Sequenz:
- His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/glucagon-like-peptide-1-glp-1-human-preproglucagon-72-108-human/

