Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin)
Produktgrößen
0.5 mg
£304,00
ECH-274-56-0.5MG
1 mg
£427,00
ECH-274-56-1MG
Über dieses Produkt
- SKU:
- ECH-274-56
- Weitere Details:
- Molecular Weight: 3525.73 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH \nSequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OH \nStorage: -20 ?C or below \n \nLeumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective ?-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form., Echelon
- Molekulargewicht:
- 3525.73
- Sequenz:
- Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/prodynorphin-228-256-porcine-dynorphin-b-29-leumorphin/
