Leumorphin (human) (Preproenkephalin B 226-254)
Produktgrößen
0.5 mg
£304,00
ECH-271-35-0.5MG
1 mg
£427,00
ECH-271-35-1MG
Über dieses Produkt
- SKU:
- ECH-271-35
- Weitere Details:
- Molecular Weight: 3349.65 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OH \nSequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYSGELFDA-OH \nStorage: -20 ?C or below \n \nLeumorphin is an endogenous opioid peptide which corresponds to the 226-254 fragment of Preproenkephalin B. It is also known as Dynorphin B1-29. Leumorphin is potent and selective ?-opioid receptor agonist., Echelon
- Molekulargewicht:
- 3349.65
- Sequenz:
- Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OH \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/leumorphin-human-preproenkephalin-b-226-254/
