Calcitonin, salmon [Des-Cys1]
Produktgrößen
1 mg
£427,00
ECH-237-34-1MG
Über dieses Produkt
- SKU:
- ECH-237-34
- Weitere Details:
- Molecular Weight: 3328.73 \nSalt Form: TFA \nPurity: >95% \nSequence (3-letter): Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 \nSequence (1-letter): SNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 \nStorage: -20 ?C or below \n \nCalcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms. Calcitonin, salmon [Des-Cys1] is an analog in which the N-terminal Cys has been replaced with Ser., Echelon
- Molekulargewicht:
- 3328.73
- Sequenz:
- Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/calcitonin-salmon-des-cys1/
