Calcitonin, salmon
Produktgrößen
1 mg
£214,00
ECH-237-26-1MG
5 mg
£728,00
ECH-237-26-5MG
Über dieses Produkt
- SKU:
- ECH-237-26
- CAS Number:
- 47931-85-1
- Weitere Details:
- CAS Number: 47931-85-1 \nMolecular Weight: 3431.74 \nSalt Form: Acetate \nPurity: >96% \nSequence (3-letter): Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Cys1-Cys7) \nSequence (1-letter): CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 \nStorage: -20 ?C or below \nSolubility: 1% acetic acid to 1 mg/mL \n \nCalcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms. \nReferences \n1.Chestnut, C.H. et al. (2000) ?A randomized trial of nasal spray salmon calcitonin in postmenopausal women with established osteoporosis: the prevent recurrence of osteoporotic fractures study? Am. J. Med. 109 (4): 267?276. \n2.Manicourt, D.-H. et al. (2006) ?Oral salmon calcitonin reduces Lequesne's algofunctional index scores and decreases urinary and serum levels of biomarkers of joint metabolism in knee osteoarthritis? Arthritis Rheum. 54 (10): 3205-3211., Echelon
- Molekulargewicht:
- 3431.74
- Sequenz:
- Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Cys1-Cys7) \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/calcitonin-salmon/

