Calcitonin Gene Related Peptide II (CGRP II, human), cyclic

Produktgrößen

0.5 mg

£523,00

ECH-231-29-0.5MG

1 mg

£751,00

ECH-231-29-1MG

Über dieses Produkt

SKU:: ECH-231-29
CAS Number:: 98824-26-1
Weitere Details:: CAS Number: 98824-26-1 \nMolecular Weight: 3792.94 \nSalt Form: TFA \nPurity: >95% \nSequence (3-letter): Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 [Cys2-Cys7] \nSequence (1-letter): ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 \nStorage: -20 ?C or below \n \nCalcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRPα) and CGRP II (CGRPβ), Echelon
Molekulargewicht:: 3792.94
Sequenz:: Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 [Cys2-Cys7] \n
Versandbedingungen:: Ambient
Lagerbedingungen:: -20[o]C
Hersteller:: Echelon Biosciences
Typ:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Warenkorb