Brain Natriuretic Peptide (BNP) (1-32), human / Brain ANP (1-32), human
Produktgrößen
0.5 mg
£413,00
ECH-152-52-0.5MG
1 mg
£644,00
ECH-152-52-1MG
Über dieses Produkt
- SKU:
- ECH-152-52
- CAS Number:
- 124584-08-3
- Weitere Details:
- CAS Number: 124584-08-3 \nMolecular Weight: 3463.76 \nSalt Form: TFA \nPurity: >90% \nSequence (3-letter): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26] \nSequence (1-letter): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH \nStorage: -20 ?C or below \n \nBrain Natriuretic Peptide (BNP) (1-32) is a bioactive fragment of the 108-aa inactive precursor pro-BNP. Like all natriuretic peptides, BNP (1-32) has an important role in cardiac homeostasis. It binds to the NPR-A receptor and its actions include vasodilation and inhibition of the renal-angiotensin-aldosterone sysntem (RAAS)., Echelon
- Molekulargewicht:
- 3463.76
- Sequenz:
- Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26] \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/brain-natriuretic-peptide-bnp-1-32-human-brain-anp-1-32-human/

