ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human
Produktgrößen
1 mg
£338,00
ECH-111-45-1MG
5 mg
£1134,00
ECH-111-45-5MG
Über dieses Produkt
- SKU:
- ECH-111-45
- CAS Number:
- 68563-24-6
- Weitere Details:
- CAS Number: 68563-24-6 \nMolecular Weight: 3656.92 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH \nSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH \nStorage: -20 ?C or below \n \nACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors., Echelon
- Molekulargewicht:
- 3656.92
- Sequenz:
- Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH \n
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Echelon Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:https://www.echelon-inc.com/product/acth-7-38-human-corticotropin-inhibiting-peptide-7-38-human/

