Ataxin 1 Antibody
Produktgrößen
100ug
£593,00
OASE00303-100UG
Über dieses Produkt
- SKU:
- OASE00303
- Zusätzliche Namen:
- Ataxin-1; ATX1; Atxn1; D6S504E; OTTHUMP00000016065; SCA1; Spinocerebellar ataxia type 1 protein
- translate.label.attr.clone:
- S76-8
- Klonalität:
- Monoclonal
- Konjugat:
- Unconjugated
- Konzentration:
- 1 mg/ml
- Gendetails:
- ataxin 1
- Host:
- Mouse
- Immunogen:
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
- Isotyp:
- IgG2b
- Aufreinigung:
- Protein G Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- Store at -20C. Shipping with Blue Ice or 4C.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Monoclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php