DUOXA2 Antibody
Produktgrößen
25ul
£177,00
ARP64802-P050-25UL
100 ul
£412,00
ARP64802-P050-100UL
Über dieses Produkt
- SKU:
- ARP64802-P050
- Zusätzliche Namen:
- TDH5; SIMNIPHOM
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- This gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5.
- Gendetails:
- dual oxidase maturation factor 2
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV
- Molekulargewicht:
- 35 kDa
- Proteindetails:
- Dual oxidase maturation factor 2
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php