ADM2 Antibody
Produktgrößen
25ul
£177,00
ARP64721-P050-25UL
100 ul
£412,00
ARP64721-P050-100UL
Über dieses Produkt
- SKU:
- ARP64721-P050
- Zusätzliche Namen:
- AM2; dJ579N16.4
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues; acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants; encoding the same protein; have been identified.
- Gendetails:
- adrenomedullin 2
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
- Molekulargewicht:
- 16 kDa
- Proteindetails:
- ADM2
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php