GCSH Antibody
Produktgrößen
25ul
£177,00
ARP64204-P050-25UL
100 ul
£412,00
ARP64204-P050-100UL
Über dieses Produkt
- SKU:
- ARP64204-P050
- Zusätzliche Namen:
- GCE; NKH
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- Degradation of glycine is brought about by the glycine cleavage system; which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase); H protein (a lipoic acid-containing protein); T protein (a tetrahydrofolate-requiring enzyme); and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein; which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants; one protein-coding and the other probably not protein-coding;have been found for this gene. Also; several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.
- Gendetails:
- glycine cleavage system protein H (aminomethyl carrier)
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP
- Molekulargewicht:
- 19 kDa
- Proteindetails:
- Glycine cleavage system H protein; mitochondrial
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php