GALP Antibody
Produktgrößen
25ul
£177,00
ARP63211-P050-25UL
100 ul
£412,00
ARP63211-P050-100UL
Über dieses Produkt
- SKU:
- ARP63211-P050
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1; 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene; termed alarin; may have vasoactive properties and serve as a marker for neuroblastic tumors.
- Gendetails:
- galanin-like peptide
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence LLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMET
- Molekulargewicht:
- 13 kDa
- Proteindetails:
- Galanin-like peptide
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php