ATP1A2 Antibody
Produktgrößen
25ul
£177,00
ARP60207-P050-25UL
100 ul
£412,00
ARP60207-P050-100UL
Über dieses Produkt
- SKU:
- ARP60207-P050
- Zusätzliche Namen:
- FHM2; MHP2
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases; and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation; for sodium-coupled transport of a variety of organic and inorganic molecules; and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits; a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines; and in a rare syndrome known as alternating hemiplegia of childhood.
- Gendetails:
- ATPase; Na+/K+ transporting; alpha 2 polypeptide
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY
- Molekulargewicht:
- 112 kDa
- Proteindetails:
- Sodium/potassium-transporting ATPase subunit alpha-2
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php