C17orf97 Antibody
Produktgrößen
25ul
£177,00
ARP54432-P050-25UL
100 ul
£412,00
ARP54432-P050-100UL
Über dieses Produkt
- SKU:
- ARP54432-P050
- Zusätzliche Namen:
- CK20; LIAT1
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Gendetails:
- chromosome 17 open reading frame 97
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
- Molekulargewicht:
- 50 kDa
- Proteindetails:
- Uncharacterized protein C17orf97
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php