GUCY1B3 Antibody
Produktgrößen
25ul
£177,00
ARP46011-P050-25UL
100 ul
£412,00
ARP46011-P050-100UL
Über dieses Produkt
- SKU:
- ARP46011-P050
- Zusätzliche Namen:
- GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- This gene encodes the beta subunit of the soluble guanylate cyclase (sGC); which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain; which serves as a receptor for ligands such as nitric oxide; oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants.
- Gendetails:
- guanylate cyclase 1 soluble subunit beta 1
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
- Molekulargewicht:
- 71 kDa
- Proteindetails:
- guanylate cyclase soluble subunit beta-1
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php