FZD10 Antibody
Produktgrößen
25ul
£177,00
ARP41263-P050-25UL
100 ul
£412,00
ARP41263-P050-100UL
Über dieses Produkt
- SKU:
- ARP41263-P050
- Zusätzliche Namen:
- Fz10; FzE7; CD350; FZ-10; hFz10
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis; expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
- Gendetails:
- frizzled family receptor 10
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
- Molekulargewicht:
- 65 kDa
- Proteindetails:
- Frizzled-10
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php