CDKN2C Antibody
Produktgrößen
25ul
£177,00
ARP30196-P050-25UL
100 ul
£412,00
ARP30196-P050-100UL
Über dieses Produkt
- SKU:
- ARP30196-P050
- Zusätzliche Namen:
- p18; INK4C; p18-INK4C
- Klonalität:
- Polyclonal
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6; and prevent the activation of the CDK kinases; thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis; as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene; which encode an identical protein; have been reported.
- Gendetails:
- cyclin-dependent kinase inhibitor 2C (p18; inhibits CDK4)
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ
- Molekulargewicht:
- 18 kDa
- Proteindetails:
- Cyclin-dependent kinase 4 inhibitor C
- Aufreinigung:
- Affinity Purified
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Hersteller:
- Aviva Systems Biology
- Typ:
- Antibodies: Polyclonal Antibody
- Datenblatt des Herstellers:html_datasheet.php