Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric monoclonal antibody FL550 Conjugate
Produktgrößen
200 ul
£657,00
78-002-FL550-200UL
Über dieses Produkt
- SKU:
- 78-002-FL550
- Zusätzliche Namen:
- Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
- Anwendung:
- Immunocytochemistry, Immunohistochemistry
- CE/IVD:
- RUO
- translate.label.attr.clone:
- L21/32
- Klonalität:
- Recombinant Monoclonal
- Konjugat:
- FL550
- Konzentration:
- 0.5 mg/ml
- Weitere Details:
- Our chicken Anti-GluA2/GluR2 glutamate receptor FL550 conjugate recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in IHC, ICC., Aves Labs
- Host:
- Chicken/Avian
- Immunogen:
- Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
- Isotyp:
- IgY
- Molekulargewicht:
- 90 kDa
- Physischer Zustand:
- Liquid
- Aufreinigung:
- Purified by affinity chromatography|This recombinant antibody is a chimeric antibody created by replacing the mouse heavy and light constant regions of clone L21/32 with chicken IgY heavy and light co
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Hersteller:
- Aves Labs
- Typ:
- Antibody: Recombinant Antibodies