Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric monoclonal antibody (BSA and Azide free)
Produktgrößen
100 ul
£611,00
78-002-CF-100UL
Über dieses Produkt
- SKU:
- 78-002-CF
- Zusätzliche Namen:
- Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
- Anwendung:
- Electron Microscopy, ELISA, Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, Western Blot
- Buffer:
- 1
- CE/IVD:
- RUO
- translate.label.attr.clone:
- L21/32
- Klonalität:
- Recombinant Monoclonal
- Konzentration:
- 1 mg/ml
- Weitere Details:
- Our chicken Anti-GluA2/GluR2 glutamate receptor carrier-free recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, ELISA., Aves Labs
- Formulierung:
- 1
- Host:
- Chicken/Avian
- Immunogen:
- Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
- Isotyp:
- IgY
- Molekulargewicht:
- 90 kDa
- Physischer Zustand:
- Liquid
- Aufreinigung:
- Purified by affinity chromatography|This recombinant antibody is a chimeric antibody created by replacing the mouse heavy and light constant regions of clone L21/32 with chicken IgY heavy and light co
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Hersteller:
- Aves Labs
- Typ:
- Antibody: Recombinant Antibodies